GOLGA7B anticorps (N-Term)

N° du produit ABIN632779

Détail du produit anti-GOLGA7B anticorps

Antigène: GOLGA7B (Golgin A7 Family, Member B (GOLGA7B))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GOLGA7B est non-conjugé

Application: Western Blotting (WB)

Specificité: C10 ORF132 antibody was raised against the N terminal Of C10 rf132

Purification: Affinity purified

Immunogène: C10 ORF132 antibody was raised using the N terminal Of C10 rf132 corresponding to a region with amino acids MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C10ORF132 Blocking Peptide, catalog no. 33R-5771, is also available for use as a blocking control in assays to test for specificity of this C10ORF132 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF132 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GOLGA7B

Antigène: GOLGA7B (Golgin A7 Family, Member B (GOLGA7B))

Autre désignation: C10ORF132 (GOLGA7B Produits)

Synonymes: anticorps 4933417O08Rik, anticorps AI839934, anticorps C10orf132, anticorps C10orf133, anticorps bA451M19.3, anticorps bA459F3.4, anticorps golgin A7 family, member B, anticorps golgin A7 family, member Bb, anticorps golgi autoantigen, golgin subfamily a, 7B, anticorps golgin A7 family member B, anticorps Golga7b, anticorps golga7bb, anticorps GOLGA7B

Sujet: C10orf132 may be involved in protein transport from Golgi to cell surface (By similarity).

Poids moléculaire: 18 kDa (MW of target protein)