PGBD2 anticorps (Middle Region)

N° du produit ABIN632783

Détail du produit anti-PGBD2 anticorps

Antigène: PGBD2 (PiggyBac Transposable Element Derived 2 (PGBD2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGBD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PGBD2 antibody was raised against the middle region of PGBD2

Purification: Affinity purified

Immunogène: PGBD2 antibody was raised using the middle region of PGBD2 corresponding to a region with amino acids RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGBD2 Blocking Peptide, catalog no. 33R-7960, is also available for use as a blocking control in assays to test for specificity of this PGBD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGBD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PGBD2

Antigène: PGBD2 (PiggyBac Transposable Element Derived 2 (PGBD2))

Autre désignation: PGBD2 (PGBD2 Produits)

Synonymes: anticorps piggyBac transposable element derived 2, anticorps PGBD2, anticorps Pgbd2

Sujet: The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known.

Poids moléculaire: 39 kDa (MW of target protein)