CCDC7 anticorps (N-Term)

N° du produit ABIN632784

Cet anticorps anti-CCDC7 est un anticorps Polyclonal produit chez le Lapin, détectant CCDC7 dans WB. Convient pour Humain.

Aperçu rapide pour CCDC7 anticorps (N-Term) (ABIN632784)

Antigène: CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CCDC7 anticorps

Épitope: N-Term

Specificité: CCDC7 antibody was raised against the N terminal of CCDC7

Purification: Affinity purified

Immunogène: CCDC7 antibody was raised using the N terminal of CCDC7 corresponding to a region with amino acids KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC7 Blocking Peptide, (ABIN939801), is also available for use as a blocking control in assays to test for specificity of this CCDC7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC7

Antigène: CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))

Autre désignation: CCDC7

Sujet: The function of CCDC7 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 56 kDa (MW of target protein)