CCDC7 anticorps (N-Term)

N° du produit ABIN632784

Détail du produit anti-CCDC7 anticorps

Antigène: CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC7 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC7 antibody was raised against the N terminal of CCDC7

Purification: Affinity purified

Immunogène: CCDC7 antibody was raised using the N terminal of CCDC7 corresponding to a region with amino acids KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC7 Blocking Peptide, catalog no. 33R-4415, is also available for use as a blocking control in assays to test for specificity of this CCDC7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC7

Antigène: CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))

Autre désignation: CCDC7 (CCDC7 Produits)

Synonymes: anticorps dJ1104A8.1, anticorps 4930517G15Rik, anticorps 4930540C21Rik, anticorps Biot2, anticorps CCDC7, anticorps QtsA-13472, anticorps coiled-coil domain containing 7, anticorps coiled-coil domain containing 7A, anticorps uncharacterized protein C10orf68, anticorps coiled-coil domain-containing protein 7, anticorps Coiled-coil domain-containing protein 7, anticorps CCDC7, anticorps Ccdc7a, anticorps Ccdc7, anticorps LOC616662, anticorps LOC103350869, anticorps LOC100060704

Sujet: The function of CCDC7 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 56 kDa (MW of target protein)