C12orf42 anticorps (N-Term)

N° du produit ABIN632789

Détail du produit anti-C12orf42 anticorps

Antigène: C12orf42 (Chromosome 12 Open Reading Frame 42 (C12orf42))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C12orf42 est non-conjugé

Application: Western Blotting (WB)

Specificité: C12 ORF42 antibody was raised against the N terminal Of C12 rf42

Purification: Affinity purified

Immunogène: C12 ORF42 antibody was raised using the N terminal Of C12 rf42 corresponding to a region with amino acids PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C12ORF42 Blocking Peptide, catalog no. 33R-7319, is also available for use as a blocking control in assays to test for specificity of this C12ORF42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C12orf42

Antigène: C12orf42 (Chromosome 12 Open Reading Frame 42 (C12orf42))

Autre désignation: C12ORF42 (C12orf42 Produits)

Synonymes: anticorps chromosome 12 open reading frame 42, anticorps C12orf42

Sujet: The function of C12orf42 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 40 kDa (MW of target protein)