AKR7A3 anticorps

N° du produit ABIN632796

Cet anticorps anti-AKR7A3 est un anticorps Lapin Polyclonal détectant AKR7A3 dans WB. Adapté pour Humain.

Aperçu rapide pour AKR7A3 anticorps (ABIN632796)

Antigène: AKR7A3 (Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKR7A3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AKR7A3 anticorps

Purification: Affinity purified

Immunogène: AKR7 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AKR7A3 Blocking Peptide, (ABIN5611994), is also available for use as a blocking control in assays to test for specificity of this AKR7A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AKR7A3

Antigène: AKR7A3 (Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3))

Autre désignation: AKR7A3

Sujet: Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.

Poids moléculaire: 37 kDa (MW of target protein)