AKR7A3 anticorps
-
- Antigène Voir toutes AKR7A3 Anticorps
- AKR7A3 (Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AKR7A3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- AKR7 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW
- Top Product
- Discover our top product AKR7A3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AKR7A3 Blocking Peptide, catalog no. 33R-9513, is also available for use as a blocking control in assays to test for specificity of this AKR7A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AKR7A3 (Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3))
- Autre désignation
- AKR7A3 (AKR7A3 Produits)
- Synonymes
- anticorps AFAR2, anticorps fd56g11, anticorps wu:fd56g11, anticorps zgc:92502, anticorps AKR7A2, anticorps Afar, anticorps Akr7a1, anticorps aldo-keto reductase family 7 member A3, anticorps aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase), anticorps aflatoxin B1 aldehyde reductase member 3, anticorps AKR7A3, anticorps akr7a3, anticorps LOC788425, anticorps Akr7a3
- Sujet
- Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.
- Poids moléculaire
- 37 kDa (MW of target protein)
-