FAM50B anticorps (N-Term)

N° du produit ABIN632799

Cet anticorps anti-FAM50B est un anticorps Lapin Polyclonal détectant FAM50B dans WB. Adapté pour Humain.

Aperçu rapide pour FAM50B anticorps (N-Term) (ABIN632799)

Antigène: FAM50B (Family with Sequence Similarity 50, Member B (FAM50B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM50B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM50B anticorps

Épitope: N-Term

Specificité: FAM50 B antibody was raised against the N terminal of FAM50

Purification: Affinity purified

Immunogène: FAM50 B antibody was raised using the N terminal of FAM50 corresponding to a region with amino acids IAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTLNDMKARQEALVRER

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM50B Blocking Peptide, (ABIN939276), is also available for use as a blocking control in assays to test for specificity of this FAM50B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM50B

Antigène: FAM50B (Family with Sequence Similarity 50, Member B (FAM50B))

Autre désignation: FAM50B

Sujet: FAM50B may be involved in growth regulation.

Poids moléculaire: 39 kDa (MW of target protein)