PTGR1 anticorps (N-Term)

N° du produit ABIN632800

Cet anticorps Lapin Polyclonal détecte spécifiquement PTGR1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour PTGR1 anticorps (N-Term) (ABIN632800)

Antigène: PTGR1 (Prostaglandin Reductase 1 (PTGR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTGR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PTGR1 anticorps

Épitope: N-Term

Specificité: LTB4 DH antibody was raised against the N terminal Of Ltb4 h

Purification: Affinity purified

Immunogène: LTB4 DH antibody was raised using the N terminal Of Ltb4 h corresponding to a region with amino acids VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LTB4DH Blocking Peptide, (ABIN5614604), is also available for use as a blocking control in assays to test for specificity of this LTB4DH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTB0 H antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTGR1

Antigène: PTGR1 (Prostaglandin Reductase 1 (PTGR1))

Autre désignation: LTB4DH

Sujet: LTB4DH functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. LTB4DH catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.

Poids moléculaire: 36 kDa (MW of target protein)