PTGR1 anticorps (N-Term)

N° du produit ABIN632800

Détail du produit anti-PTGR1 anticorps

Antigène: PTGR1 (Prostaglandin Reductase 1 (PTGR1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTGR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LTB4 DH antibody was raised against the N terminal Of Ltb4 h

Purification: Affinity purified

Immunogène: LTB4 DH antibody was raised using the N terminal Of Ltb4 h corresponding to a region with amino acids VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LTB4DH Blocking Peptide, catalog no. 33R-9791, is also available for use as a blocking control in assays to test for specificity of this LTB4DH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTB0 H antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTGR1

Antigène: PTGR1 (Prostaglandin Reductase 1 (PTGR1))

Autre désignation: LTB4DH (PTGR1 Produits)

Synonymes: anticorps LTB4DH, anticorps PGR1, anticorps ZADH3, anticorps 2510002C21Rik, anticorps Ltb4dh, anticorps Dig1, anticorps ltb4dh, anticorps wu:fj35e05, anticorps zgc:101689, anticorps PTGR1, anticorps prostaglandin reductase 1, anticorps PTGR1, anticorps Ptgr1, anticorps ptgr1

Sujet: LTB4DH functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. LTB4DH catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.

Poids moléculaire: 36 kDa (MW of target protein)