R3HDM2 anticorps (Middle Region)

N° du produit ABIN632805

Cet anticorps anti-R3HDM2 est un anticorps Lapin Polyclonal détectant R3HDM2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour R3HDM2 anticorps (Middle Region) (ABIN632805)

Antigène: R3HDM2 (R3H Domain Containing 2 (R3HDM2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp R3HDM2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-R3HDM2 anticorps

Épitope: Middle Region

Specificité: R3 HDM2 antibody was raised against the middle region of R3 DM2

Purification: Affinity purified

Immunogène: R3 HDM2 antibody was raised using the middle region of R3 DM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

R3HDM2 Blocking Peptide, (ABIN5615696), is also available for use as a blocking control in assays to test for specificity of this R3HDM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of R0 DM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur R3HDM2

Antigène: R3HDM2 (R3H Domain Containing 2 (R3HDM2))

Autre désignation: R3HDM2

Sujet: R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.

Poids moléculaire: 68 kDa (MW of target protein)