ZCCHC14 anticorps (N-Term)

N° du produit ABIN632807

Détail du produit anti-ZCCHC14 anticorps

Antigène: ZCCHC14 (Zinc Finger, CCHC Domain Containing 14 (ZCCHC14))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZCCHC14 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZCCHC14 antibody was raised against the N terminal of ZCCHC14

Purification: Affinity purified

Immunogène: ZCCHC14 antibody was raised using the N terminal of ZCCHC14 corresponding to a region with amino acids RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZCCHC14 Blocking Peptide, catalog no. 33R-8278, is also available for use as a blocking control in assays to test for specificity of this ZCCHC14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZCCHC14

Antigène: ZCCHC14 (Zinc Finger, CCHC Domain Containing 14 (ZCCHC14))

Autre désignation: ZCCHC14 (ZCCHC14 Produits)

Synonymes: anticorps MGC131346, anticorps BDG-29, anticorps BDG29, anticorps AA792890, anticorps RGD1309494, anticorps zinc finger CCHC-type containing 14, anticorps zinc finger CCHC-type containing 14 L homeolog, anticorps zinc finger CCHC domain-containing protein 14, anticorps zinc finger, CCHC domain containing 14, anticorps ZCCHC14, anticorps zcchc14.L, anticorps LOC100082786, anticorps zcchc14, anticorps LOC100539002, anticorps Zcchc14

Sujet: ZCCHC14 contains 1 CCHC-type zinc finger. The function of ZCCHC14 remains unknown.

Poids moléculaire: 100 kDa (MW of target protein)