MAU2/KIAA0892 anticorps (Middle Region)

N° du produit ABIN632809

Détail du produit anti-MAU2/KIAA0892 anticorps

Antigène: MAU2/KIAA0892 (MAU2) (MAU2 Sister Chromatid Cohesion Factor (MAU2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAU2/KIAA0892 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIAA0892 antibody was raised against the middle region of KIAA0892

Purification: Affinity purified

Immunogène: KIAA0892 antibody was raised using the middle region of KIAA0892 corresponding to a region with amino acids MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA0892 Blocking Peptide, catalog no. 33R-6099, is also available for use as a blocking control in assays to test for specificity of this KIAA0892 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0892 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAU2/KIAA0892

Antigène: MAU2/KIAA0892 (MAU2) (MAU2 Sister Chromatid Cohesion Factor (MAU2))

Autre désignation: KIAA0892 (MAU2 Produits)

Synonymes: anticorps scc4, anticorps mau-2, anticorps kiaa0892, anticorps 9130404D08Rik, anticorps A930019L04Rik, anticorps C77863, anticorps C79014, anticorps Mau-2, anticorps mKIAA0892, anticorps KIAA0892, anticorps MAU2L, anticorps SCC4, anticorps MAU2 sister chromatid cohesion factor, anticorps MAU2, sister chromatid cohesion factor, anticorps MAU2, sister chromatid cohesion factor S homeolog, anticorps MAU2, anticorps mau2, anticorps mau2.S, anticorps Mau2

Sujet: KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.

Poids moléculaire: 69 kDa (MW of target protein)