EML3 anticorps (N-Term)

N° du produit ABIN632829

Détail du produit anti-EML3 anticorps

Antigène: EML3 (Echinoderm Microtubule Associated Protein Like 3 (EML3))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EML3 est non-conjugé

Application: Western Blotting (WB)

Specificité: EML3 antibody was raised against the N terminal of EML3

Purification: Affinity purified

Immunogène: EML3 antibody was raised using the N terminal of EML3 corresponding to a region with amino acids LLVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EML3 Blocking Peptide, catalog no. 33R-5198, is also available for use as a blocking control in assays to test for specificity of this EML3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EML3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EML3

Antigène: EML3 (Echinoderm Microtubule Associated Protein Like 3 (EML3))

Autre désignation: EML3 (EML3 Produits)

Synonymes: anticorps BC022146, anticorps ELP95, anticorps RGD1311368, anticorps echinoderm microtubule associated protein like 3, anticorps Eml3, anticorps EML3

Sujet: EML3 may modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.

Poids moléculaire: 95 kDa (MW of target protein)