TRIML2 anticorps (Middle Region)

N° du produit ABIN632830

Détail du produit anti-TRIML2 anticorps

Antigène: TRIML2 (Tripartite Motif Family-Like 2 (TRIML2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIML2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIML2 antibody was raised against the middle region of TRIML2

Purification: Affinity purified

Immunogène: TRIML2 antibody was raised using the middle region of TRIML2 corresponding to a region with amino acids SEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVEKAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIML2 Blocking Peptide, catalog no. 33R-8386, is also available for use as a blocking control in assays to test for specificity of this TRIML2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIML2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIML2

Antigène: TRIML2 (Tripartite Motif Family-Like 2 (TRIML2))

Autre désignation: TRIML2 (TRIML2 Produits)

Synonymes: anticorps SPRYD6, anticorps RGD1565382, anticorps Tu4, anticorps EG622117, anticorps tripartite motif family like 2, anticorps tripartite motif family-like 2, anticorps TRIML2, anticorps Triml2

Sujet: The specific function of TRIML2 is not yet known.

Poids moléculaire: 44 kDa (MW of target protein)