KRT18P55 anticorps (N-Term)

N° du produit ABIN632836

Détail du produit anti-KRT18P55 anticorps

Antigène: KRT18P55 (Keratin 18 Pseudogene 55 (KRT18P55))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KRT18P55 est non-conjugé

Application: Western Blotting (WB)

Specificité: FLJ40504 antibody was raised against the N terminal of FLJ40504

Purification: Affinity purified

Immunogène: FLJ40504 antibody was raised using the N terminal of FLJ40504 corresponding to a region with amino acids MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ40504 Blocking Peptide, catalog no. 33R-5837, is also available for use as a blocking control in assays to test for specificity of this FLJ40504 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ40504 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KRT18P55

Antigène: KRT18P55 (Keratin 18 Pseudogene 55 (KRT18P55))

Autre désignation: FLJ40504 (KRT18P55 Produits)

Synonymes: anticorps keratin 18 pseudogene 55, anticorps KRT18P55

Sujet: The specific function of FFLJ40504 is not yet known.

Poids moléculaire: 29 kDa (MW of target protein)