C5orf36 anticorps (N-Term)

N° du produit ABIN632837

L’anticorps Lapin Polyclonal anti-C5orf36 a été validé pour WB. Il convient pour détecter C5orf36 dans des échantillons de Humain.

Aperçu rapide pour C5orf36 anticorps (N-Term) (ABIN632837)

Antigène: C5orf36 (Chromosome 5 Open Reading Frame 36 (C5orf36))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C5orf36 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C5orf36 anticorps

Épitope: N-Term

Specificité: C5 ORF36 antibody was raised against the N terminal Of C5 rf36

Purification: Affinity purified

Immunogène: C5 ORF36 antibody was raised using the N terminal Of C5 rf36 corresponding to a region with amino acids CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C5ORF36 Blocking Peptide, (ABIN937067), is also available for use as a blocking control in assays to test for specificity of this C5ORF36 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF36 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C5orf36

Antigène: C5orf36 (Chromosome 5 Open Reading Frame 36 (C5orf36))

Autre désignation: C5ORF36

Sujet: The specific function of C5orf36 is not yet known.

Poids moléculaire: 37 kDa (MW of target protein)