C5orf36 anticorps (N-Term)

N° du produit ABIN632837

Détail du produit anti-C5orf36 anticorps

Antigène: C5orf36 (Chromosome 5 Open Reading Frame 36 (C5orf36))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C5orf36 est non-conjugé

Application: Western Blotting (WB)

Specificité: C5 ORF36 antibody was raised against the N terminal Of C5 rf36

Purification: Affinity purified

Immunogène: C5 ORF36 antibody was raised using the N terminal Of C5 rf36 corresponding to a region with amino acids CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C5ORF36 Blocking Peptide, catalog no. 33R-1681, is also available for use as a blocking control in assays to test for specificity of this C5ORF36 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF36 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C5orf36

Antigène: C5orf36 (Chromosome 5 Open Reading Frame 36 (C5orf36))

Autre désignation: C5ORF36 (C5orf36 Produits)

Synonymes: anticorps C5orf36, anticorps KIAA0825, anticorps KIAA0825

Sujet: The specific function of C5orf36 is not yet known.

Poids moléculaire: 37 kDa (MW of target protein)