LYPD5 anticorps (N-Term)

N° du produit ABIN632843

Détail du produit anti-LYPD5 anticorps

Antigène: LYPD5 (LY6/PLAUR Domain Containing 5 (LYPD5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYPD5 est non-conjugé

Application: Western Blotting (WB)

Specificité: LYPD5 antibody was raised against the N terminal of LYPD5

Purification: Affinity purified

Immunogène: LYPD5 antibody was raised using the N terminal of LYPD5 corresponding to a region with amino acids WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYPD5 Blocking Peptide, catalog no. 33R-10024, is also available for use as a blocking control in assays to test for specificity of this LYPD5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYPD5

Antigène: LYPD5 (LY6/PLAUR Domain Containing 5 (LYPD5))

Autre désignation: LYPD5 (LYPD5 Produits)

Synonymes: anticorps RGD1560355, anticorps PRO4356, anticorps 2210003I03Rik, anticorps Ly6/Plaur domain containing 5, anticorps LY6/PLAUR domain containing 5, anticorps Lypd5, anticorps LYPD5

Sujet: The function of LYPD5 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 22 kDa (MW of target protein)