LYPD5 anticorps (N-Term)
-
- Antigène Voir toutes LYPD5 Anticorps
- LYPD5 (LY6/PLAUR Domain Containing 5 (LYPD5))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LYPD5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LYPD5 antibody was raised against the N terminal of LYPD5
- Purification
- Affinity purified
- Immunogène
- LYPD5 antibody was raised using the N terminal of LYPD5 corresponding to a region with amino acids WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP
- Top Product
- Discover our top product LYPD5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LYPD5 Blocking Peptide, catalog no. 33R-10024, is also available for use as a blocking control in assays to test for specificity of this LYPD5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LYPD5 (LY6/PLAUR Domain Containing 5 (LYPD5))
- Autre désignation
- LYPD5 (LYPD5 Produits)
- Synonymes
- anticorps RGD1560355, anticorps PRO4356, anticorps 2210003I03Rik, anticorps Ly6/Plaur domain containing 5, anticorps LY6/PLAUR domain containing 5, anticorps Lypd5, anticorps LYPD5
- Sujet
- The function of LYPD5 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 22 kDa (MW of target protein)
-