FAM131C anticorps (Middle Region)

N° du produit ABIN632844

Détail du produit anti-FAM131C anticorps

Antigène: FAM131C (Family with Sequence Similarity 131, Member C (FAM131C))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM131C est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM131 C antibody was raised against the middle region of FAM131

Purification: Affinity purified

Immunogène: FAM131 C antibody was raised using the middle region of FAM131 corresponding to a region with amino acids RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM131C Blocking Peptide, catalog no. 33R-7936, is also available for use as a blocking control in assays to test for specificity of this FAM131C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM131C

Antigène: FAM131C (Family with Sequence Similarity 131, Member C (FAM131C))

Autre désignation: FAM131C (FAM131C Produits)

Synonymes: anticorps C1orf117, anticorps RP11-5P18.9, anticorps Gm693, anticorps family with sequence similarity 131 member C, anticorps family with sequence similarity 131, member C, anticorps FAM131C, anticorps Fam131c

Sujet: The function of FAM131 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 30 kDa (MW of target protein)