WDR53 anticorps (Middle Region)

N° du produit ABIN632845

Détail du produit anti-WDR53 anticorps

Antigène: WDR53 (WD Repeat Domain 53 (WDR53))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR53 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR53 antibody was raised against the middle region of WDR53

Purification: Affinity purified

Immunogène: WDR53 antibody was raised using the middle region of WDR53 corresponding to a region with amino acids NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR53 Blocking Peptide, catalog no. 33R-6765, is also available for use as a blocking control in assays to test for specificity of this WDR53 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR53 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR53

Antigène: WDR53 (WD Repeat Domain 53 (WDR53))

Autre désignation: WDR53 (WDR53 Produits)

Synonymes: anticorps 1500002B03Rik, anticorps AI848860, anticorps RGD1559546, anticorps WD repeat domain 53, anticorps WDR53, anticorps Wdr53

Sujet: The function of WDR53 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 39 kDa (MW of target protein)