GANC anticorps (Middle Region)

N° du produit ABIN632846

Détail du produit anti-GANC anticorps

Antigène: GANC (Glucosidase, Alpha, Neutral C (GANC))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GANC est non-conjugé

Application: Western Blotting (WB)

Specificité: GANC antibody was raised against the middle region of GANC

Purification: Affinity purified

Immunogène: GANC antibody was raised using the middle region of GANC corresponding to a region with amino acids VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GANC Blocking Peptide, catalog no. 33R-9658, is also available for use as a blocking control in assays to test for specificity of this GANC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GANC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GANC

Antigène: GANC (Glucosidase, Alpha, Neutral C (GANC))

Autre désignation: GANC (GANC Produits)

Synonymes: anticorps 5830445O15Rik, anticorps 9330160A12, anticorps mFLJ00088, anticorps glucosidase alpha, neutral C, anticorps calpain-3, anticorps glucosidase, alpha; neutral C, anticorps GANC, anticorps LOC453361, anticorps ganc, anticorps Ganc

Sujet: GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety.

Poids moléculaire: 104 kDa (MW of target protein)