HDDC3 anticorps (Middle Region)

N° du produit ABIN632847

Détail du produit anti-HDDC3 anticorps

Antigène: HDDC3 (HD Domain Containing 3 (HDDC3))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HDDC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: HDDC3 antibody was raised against the middle region of HDDC3

Purification: Affinity purified

Immunogène: HDDC3 antibody was raised using the middle region of HDDC3 corresponding to a region with amino acids TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HDDC3 Blocking Peptide, catalog no. 33R-9007, is also available for use as a blocking control in assays to test for specificity of this HDDC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDDC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HDDC3

Antigène: HDDC3 (HD Domain Containing 3 (HDDC3))

Autre désignation: HDDC3 (HDDC3 Produits)

Synonymes: anticorps MESH1, anticorps zgc:110184, anticorps 1110033O09Rik, anticorps C86475, anticorps RGD1311839, anticorps HD domain containing 3, anticorps HD domain containing 3 S homeolog, anticorps hddc3, anticorps HDDC3, anticorps hddc3.S, anticorps Hddc3

Sujet: The function of HDDC3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 16 kDa (MW of target protein)