HDDC3 anticorps (Middle Region)

N° du produit ABIN632847

Cet anticorps anti-HDDC3 Polyclonal Lapin (ABIN632847) détecte spécifiquement HDDC3 dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour HDDC3 anticorps (Middle Region) (ABIN632847)

Antigène: HDDC3 (HD Domain Containing 3 (HDDC3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HDDC3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HDDC3 anticorps

Épitope: Middle Region

Specificité: HDDC3 antibody was raised against the middle region of HDDC3

Purification: Affinity purified

Immunogène: HDDC3 antibody was raised using the middle region of HDDC3 corresponding to a region with amino acids TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HDDC3 Blocking Peptide, (ABIN5613976), is also available for use as a blocking control in assays to test for specificity of this HDDC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDDC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HDDC3

Antigène: HDDC3 (HD Domain Containing 3 (HDDC3))

Autre désignation: HDDC3

Sujet: The function of HDDC3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 16 kDa (MW of target protein)