C3orf62 anticorps (Middle Region)
-
- Antigène Tous les produits C3orf62
- C3orf62 (Chromosome 3 Open Reading Frame 62 (C3orf62))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C3orf62 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C3 ORF62 antibody was raised against the middle region of C3 rf62
- Purification
- Affinity purified
- Immunogène
- C3 ORF62 antibody was raised using the middle region of C3 rf62 corresponding to a region with amino acids IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C3ORF62 Blocking Peptide, catalog no. 33R-3915, is also available for use as a blocking control in assays to test for specificity of this C3ORF62 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF62 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C3orf62 (Chromosome 3 Open Reading Frame 62 (C3orf62))
- Autre désignation
- C3ORF62 (C3orf62 Produits)
- Synonymes
- anticorps chromosome 3 open reading frame 62, anticorps C3orf62
- Sujet
- The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 30 kDa (MW of target protein)
-