HEATR4 anticorps (N-Term)

N° du produit ABIN632853

Détail du produit anti-HEATR4 anticorps

Antigène: HEATR4 (HEAT Repeat Containing 4 (HEATR4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HEATR4 est non-conjugé

Application: Western Blotting (WB)

Specificité: HEATR4 antibody was raised against the N terminal of HEATR4

Purification: Affinity purified

Immunogène: HEATR4 antibody was raised using the N terminal of HEATR4 corresponding to a region with amino acids VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HEATR4 Blocking Peptide, catalog no. 33R-9524, is also available for use as a blocking control in assays to test for specificity of this HEATR4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEATR4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HEATR4

Antigène: HEATR4 (HEAT Repeat Containing 4 (HEATR4))

Autre désignation: HEATR4 (HEATR4 Produits)

Synonymes: anticorps HEAT repeat containing 4, anticorps HEATR4

Sujet: The function of the HEATR4 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 112 kDa (MW of target protein)