C17orf82 anticorps (N-Term)

N° du produit ABIN632856

Cet anticorps anti-C17orf82 est un anticorps Lapin Polyclonal détectant C17orf82 dans WB. Adapté pour Humain.

Aperçu rapide pour C17orf82 anticorps (N-Term) (ABIN632856)

Antigène: C17orf82 (Chromosome 17 Open Reading Frame 82 (C17orf82))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C17orf82 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C17orf82 anticorps

Épitope: N-Term

Specificité: C17 ORF82 antibody was raised against the N terminal Of C17 rf82

Purification: Affinity purified

Immunogène: C17 ORF82 antibody was raised using the N terminal Of C17 rf82 corresponding to a region with amino acids MGRPLEGQPLRALDLYPEPAFLRSGKDPKSSPASSPSFAVLGPEVRSTGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C17ORF82 Blocking Peptide, (ABIN5612430), is also available for use as a blocking control in assays to test for specificity of this C17ORF82 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF82 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C17orf82

Antigène: C17orf82 (Chromosome 17 Open Reading Frame 82 (C17orf82))

Autre désignation: C17ORF82

Sujet: The function of Chromosome 17 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 25 kDa (MW of target protein)