IER5L anticorps (Middle Region)

N° du produit ABIN632857

Cet anticorps Lapin Polyclonal détecte spécifiquement IER5L dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour IER5L anticorps (Middle Region) (ABIN632857)

Antigène: IER5L (Immediate Early Response 5-Like (IER5L))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IER5L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IER5L anticorps

Épitope: Middle Region

Specificité: IER5 L antibody was raised against the middle region of IER5

Purification: Affinity purified

Immunogène: IER5 L antibody was raised using the middle region of IER5 corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IER5L Blocking Peptide, (ABIN5614139), is also available for use as a blocking control in assays to test for specificity of this IER5L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IER0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IER5L

Antigène: IER5L (Immediate Early Response 5-Like (IER5L))

Autre désignation: IER5L

Sujet: The function of IER5 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 42 kDa (MW of target protein)