GADL1 anticorps (Middle Region)

N° du produit ABIN632859

Cet anticorps anti-GADL1 Polyclonal Lapin (ABIN632859) détecte spécifiquement GADL1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour GADL1 anticorps (Middle Region) (ABIN632859)

Antigène: GADL1 (Glutamate Decarboxylase-Like 1 (GADL1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GADL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GADL1 anticorps

Épitope: Middle Region

Specificité: GADL1 antibody was raised against the middle region of GADL1

Purification: Affinity purified

Immunogène: GADL1 antibody was raised using the middle region of GADL1 corresponding to a region with amino acids SAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GADL1 Blocking Peptide, (ABIN5613703), is also available for use as a blocking control in assays to test for specificity of this GADL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GADL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GADL1

Antigène: GADL1 (Glutamate Decarboxylase-Like 1 (GADL1))

Autre désignation: GADL1

Sujet: The function of GADL1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 38 kDa (MW of target protein)