FLJ35767 (Middle Region) anticorps

N° du produit ABIN632861

L’anticorps anti-FLJ35767 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de FLJ35767 dans des échantillons provenant de Humain. }

Aperçu rapide pour FLJ35767 (Middle Region) anticorps (ABIN632861)

Antigène: FLJ35767

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: Middle Region

Specificité: FLJ35767 antibody was raised against the middle region of FLJ35767

Purification: Affinity purified

Immunogène: FLJ35767 antibody was raised using the middle region of FLJ35767 corresponding to a region with amino acids PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ35767 Blocking Peptide, (ABIN5613613), is also available for use as a blocking control in assays to test for specificity of this FLJ35767 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ35767 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: FLJ35767

Sujet: The function of FLJ35767 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 18 kDa (MW of target protein)