C1orf103 anticorps (N-Term)

N° du produit ABIN632871

Détail du produit anti-C1orf103 anticorps

Antigène: C1orf103 (Chromosome 1 Open Reading Frame 103 (C1orf103))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1orf103 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF103 antibody was raised against the N terminal Of C1 rf103

Purification: Affinity purified

Immunogène: C1 ORF103 antibody was raised using the N terminal Of C1 rf103 corresponding to a region with amino acids KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF103 Blocking Peptide, catalog no. 33R-4472, is also available for use as a blocking control in assays to test for specificity of this C1ORF103 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF103 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1orf103

Antigène: C1orf103 (Chromosome 1 Open Reading Frame 103 (C1orf103))

Autre désignation: C1ORF103 (C1orf103 Produits)

Synonymes: anticorps C1orf103, anticorps RIF1, anticorps RP11-96K19.1, anticorps 2010012G17Rik, anticorps 4933421E11Rik, anticorps AI450568, anticorps Rif1, anticorps RGD1306520, anticorps ligand dependent nuclear receptor interacting factor 1, anticorps LRIF1, anticorps Lrif1

Sujet: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Nuclear Hormone Receptor Binding