ODF2L anticorps (N-Term)

N° du produit ABIN632872

Cet anticorps Lapin Polyclonal détecte spécifiquement ODF2L dans WB. Il présente une réactivité avec des échantillons de Humain et Rat.

Aperçu rapide pour ODF2L anticorps (N-Term) (ABIN632872)

Antigène: ODF2L (Outer Dense Fiber of Sperm Tails 2-Like (ODF2L))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ODF2L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ODF2L anticorps

Épitope: N-Term

Specificité: ODF2 L antibody was raised against the N terminal of ODF2

Purification: Affinity purified

Immunogène: ODF2 L antibody was raised using the N terminal of ODF2 corresponding to a region with amino acids KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ODF2L Blocking Peptide, (ABIN940084), is also available for use as a blocking control in assays to test for specificity of this ODF2L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ODF2L

Antigène: ODF2L (Outer Dense Fiber of Sperm Tails 2-Like (ODF2L))

Autre désignation: ODF2L

Sujet: The function of ODF2L protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 60 kDa (MW of target protein)