ODF2L anticorps (N-Term)

N° du produit ABIN632872

Détail du produit anti-ODF2L anticorps

Antigène: ODF2L (Outer Dense Fiber of Sperm Tails 2-Like (ODF2L))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ODF2L est non-conjugé

Application: Western Blotting (WB)

Specificité: ODF2 L antibody was raised against the N terminal of ODF2

Purification: Affinity purified

Immunogène: ODF2 L antibody was raised using the N terminal of ODF2 corresponding to a region with amino acids KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ODF2L Blocking Peptide, catalog no. 33R-4698, is also available for use as a blocking control in assays to test for specificity of this ODF2L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ODF2L

Antigène: ODF2L (Outer Dense Fiber of Sperm Tails 2-Like (ODF2L))

Autre désignation: ODF2L (ODF2L Produits)

Synonymes: anticorps im:7137744, anticorps wu:fc04b05, anticorps RP5-977L11.1, anticorps dJ977L11.1, anticorps 4733401D09Rik, anticorps 9630045K08Rik, anticorps D3Ertd250e, anticorps RGD1308397, anticorps outer dense fiber of sperm tails 2 like, anticorps outer dense fiber of sperm tails 2b, anticorps outer dense fiber protein 2-like, anticorps outer dense fiber of sperm tails 2-like, anticorps outer dense fiber of sperm tails 2-like L homeolog, anticorps ODF2L, anticorps odf2b, anticorps LOC100366442, anticorps Odf2l, anticorps odf2l.L

Sujet: The function of ODF2L protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 60 kDa (MW of target protein)