CHAC2 anticorps

N° du produit ABIN632873

L’anticorps anti-CHAC2 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de CHAC2 dans des échantillons provenant de Humain, Souris et Rat. }

Aperçu rapide pour CHAC2 anticorps (ABIN632873)

Antigène: CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHAC2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHAC2 anticorps

Purification: Affinity purified

Immunogène: CHAC2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHAC2 Blocking Peptide, (ABIN5612834), is also available for use as a blocking control in assays to test for specificity of this CHAC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHAC2

Antigène: CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))

Autre désignation: CHAC2

Sujet: The function of CHAC protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 21 kDa (MW of target protein)