CHAC2 anticorps
-
- Antigène Voir toutes CHAC2 Anticorps
- CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHAC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CHAC2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV
- Top Product
- Discover our top product CHAC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHAC2 Blocking Peptide, catalog no. 33R-6622, is also available for use as a blocking control in assays to test for specificity of this CHAC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))
- Autre désignation
- CHAC2 (CHAC2 Produits)
- Synonymes
- anticorps 2510006C20Rik, anticorps chac, anticorps fj84c08, anticorps im:7150709, anticorps wu:fj84c08, anticorps zgc:110055, anticorps RGD1309120, anticorps ChaC cation transport regulator homolog 2, anticorps ChaC, cation transport regulator homolog 2, anticorps ChaC, cation transport regulator 2, anticorps ChaC, cation transport regulator homolog 2 S homeolog, anticorps ChaC, cation transport regulator homolog 2 (E. coli), anticorps ChaC cation transport regulator 2, anticorps CHAC2, anticorps chac2, anticorps Chac2, anticorps chac2.S
- Sujet
- The function of CHAC protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 21 kDa (MW of target protein)
-