C9orf68 anticorps (Middle Region)

N° du produit ABIN632882

L’anticorps anti-C9orf68 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de C9orf68 dans des échantillons provenant de Humain. }

Aperçu rapide pour C9orf68 anticorps (Middle Region) (ABIN632882)

Antigène: C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C9orf68 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C9orf68 anticorps

Épitope: Middle Region

Specificité: C9 ORF68 antibody was raised against the middle region of C9 rf68

Purification: Affinity purified

Immunogène: C9 ORF68 antibody was raised using the middle region of C9 rf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C9ORF68 Blocking Peptide, (ABIN937119), is also available for use as a blocking control in assays to test for specificity of this C9ORF68 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF68 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C9orf68

Antigène: C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))

Autre désignation: C9ORF68

Sujet: The function of Chromosome 9 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 45 kDa (MW of target protein)