C9orf68 anticorps (Middle Region)
-
- Antigène Tous les produits C9orf68
- C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))
-
Épitope
- Middle Region
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C9orf68 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C9 ORF68 antibody was raised against the middle region of C9 rf68
- Purification
- Affinity purified
- Immunogène
- C9 ORF68 antibody was raised using the middle region of C9 rf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C9ORF68 Blocking Peptide, catalog no. 33R-1733, is also available for use as a blocking control in assays to test for specificity of this C9ORF68 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF68 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))
- Autre désignation
- C9ORF68 (C9orf68 Produits)
- Synonymes
- anticorps MGC131199, anticorps MGC146453, anticorps C9orf68, anticorps bA6J24.2, anticorps spermatogenesis associated 6-like L homeolog, anticorps spermatogenesis associated 6-like, anticorps spermatogenesis associated 6 like, anticorps spata6l.L, anticorps spata6l, anticorps SPATA6L
- Sujet
- The function of Chromosome 9 ORF protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 45 kDa (MW of target protein)
-