OLAH anticorps (N-Term)

N° du produit ABIN632883

Détail du produit anti-OLAH anticorps

Antigène: OLAH (Oleoyl-ACP Hydrolase (OLAH))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OLAH est non-conjugé

Application: Western Blotting (WB)

Specificité: OLAH antibody was raised against the N terminal of OLAH

Purification: Affinity purified

Immunogène: OLAH antibody was raised using the N terminal of OLAH corresponding to a region with amino acids MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OLAH Blocking Peptide, catalog no. 33R-6029, is also available for use as a blocking control in assays to test for specificity of this OLAH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLAH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OLAH

Antigène: OLAH (Oleoyl-ACP Hydrolase (OLAH))

Autre désignation: OLAH (OLAH Produits)

Synonymes: anticorps thedc1, anticorps THEDC1, anticorps AURA1, anticorps SAST, anticorps AI607300, anticorps E230009B14Rik, anticorps Thedc1, anticorps Mch, anticorps oleoyl-ACP hydrolase, anticorps S-acyl fatty acid synthase thioesterase, medium chain, anticorps olah, anticorps OLAH, anticorps LOC100349940, anticorps Olah

Sujet: OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex.

Poids moléculaire: 30 kDa (MW of target protein)