HMGCLL1 anticorps (N-Term)

N° du produit ABIN632887

Cet anticorps Lapin Polyclonal détecte spécifiquement HMGCLL1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour HMGCLL1 anticorps (N-Term) (ABIN632887)

Antigène: HMGCLL1 (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase-Like 1 (HMGCLL1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMGCLL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HMGCLL1 anticorps

Épitope: N-Term

Specificité: HMGCLL1 antibody was raised against the N terminal of HMGCLL1

Purification: Affinity purified

Immunogène: HMGCLL1 antibody was raised using the N terminal of HMGCLL1 corresponding to a region with amino acids MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HMGCLL1 Blocking Peptide, (ABIN5614027), is also available for use as a blocking control in assays to test for specificity of this HMGCLL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HMGCLL1

Antigène: HMGCLL1 (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase-Like 1 (HMGCLL1))

Autre désignation: HMGCLL1

Sujet: HMGCLL1 is involved in the catabolism of branched amino acids such as leucine.

Poids moléculaire: 36 kDa (MW of target protein)