TBC1D14 anticorps (N-Term)

N° du produit ABIN632891

Détail du produit anti-TBC1D14 anticorps

Antigène: TBC1D14 (TBC1 Domain Family, Member 14 (TBC1D14))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBC1D14 est non-conjugé

Application: Western Blotting (WB)

Specificité: TBC1 D14 antibody was raised against the N terminal of TBC1 14

Purification: Affinity purified

Immunogène: TBC1 D14 antibody was raised using the N terminal of TBC1 14 corresponding to a region with amino acids MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBC1D14 Blocking Peptide, catalog no. 33R-6536, is also available for use as a blocking control in assays to test for specificity of this TBC1D14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBC1D14

Antigène: TBC1D14 (TBC1 Domain Family, Member 14 (TBC1D14))

Autre désignation: TBC1D14 (TBC1D14 Produits)

Synonymes: anticorps fi35h01, anticorps si:dkey-120m5.1, anticorps wu:fi35h01, anticorps wu:fi42a03, anticorps DKFZp469A1818, anticorps 2810413P16Rik, anticorps AU043625, anticorps C86258, anticorps D5Ertd110e, anticorps mKIAA1322, anticorps SRF-2, anticorps TBC1 domain family member 14, anticorps TBC1 domain family, member 14, anticorps TBC1 domain family member 14 L homeolog, anticorps TBC1D14, anticorps tbc1d14, anticorps tbc1d14.L, anticorps Tbc1d14

Sujet: TBC1D14 may act as a GTPase-activating protein for Rab family proteins.

Poids moléculaire: 76 kDa (MW of target protein)