TBC1D25 anticorps (N-Term)

N° du produit ABIN632894

Détail du produit anti-TBC1D25 anticorps

Antigène: TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBC1D25 est non-conjugé

Application: Western Blotting (WB)

Specificité: TBC1 D25 antibody was raised against the N terminal of TBC1 25

Purification: Affinity purified

Immunogène: TBC1 D25 antibody was raised using the N terminal of TBC1 25 corresponding to a region with amino acids KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBC1D25 Blocking Peptide, catalog no. 33R-4721, is also available for use as a blocking control in assays to test for specificity of this TBC1D25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBC1D25

Antigène: TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))

Autre désignation: TBC1D25 (TBC1D25 Produits)

Synonymes: anticorps im:7137114, anticorps si:dkeyp-22b2.2, anticorps MG81, anticorps OATL1, anticorps 6330576A08Rik, anticorps A530047E07, anticorps DXHXS7927e, anticorps Oatl1, anticorps mMg81, anticorps RGD1559711, anticorps TBC1 domain family member 25, anticorps TBC1 domain family, member 25, anticorps TBC1D25, anticorps tbc1d25, anticorps Tbc1d25

Sujet: This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

Poids moléculaire: 76 kDa (MW of target protein)