OAZ2 anticorps (Middle Region)

N° du produit ABIN632895

Détail du produit anti-OAZ2 anticorps

Antigène: OAZ2 (Ornithine Decarboxylase Antizyme 2 (OAZ2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OAZ2 est non-conjugé

Application: Western Blotting (WB)

Specificité: OAZ2 antibody was raised against the middle region of OAZ2

Purification: Affinity purified

Immunogène: OAZ2 antibody was raised using the middle region of OAZ2 corresponding to a region with amino acids PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OAZ2 Blocking Peptide, catalog no. 33R-7012, is also available for use as a blocking control in assays to test for specificity of this OAZ2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAZ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OAZ2

Antigène: OAZ2 (Ornithine Decarboxylase Antizyme 2 (OAZ2))

Autre désignation: OAZ2 (OAZ2 Produits)

Synonymes: anticorps AZ2, anticorps AZ-2, anticorps Oaz2-ps, anticorps Sez15, anticorps AZL, anticorps oaz2, anticorps wu:fa14f04, anticorps zgc:63816, anticorps RGD1562933, anticorps si:dkey-275p19.6, anticorps ornithine decarboxylase antizyme 2, anticorps ornithine decarboxylase antizyme 1b, anticorps ornithine decarboxylase antizyme 2 S homeolog, anticorps ornithine decarboxylase antizyme 2a, anticorps OAZ2, anticorps Oaz2, anticorps oaz1b, anticorps oaz2.S, anticorps Tsp_12111, anticorps oaz2, anticorps oaz2a

Sujet: Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis.

Poids moléculaire: 21 kDa (MW of target protein)