PSMA5 anticorps

N° du produit ABIN632898

Cet anticorps anti-PSMA5 est un anticorps Lapin Polyclonal détectant PSMA5 dans WB. Adapté pour Humain, Souris, Rat, Drosophila melanogaster et C. elegans.

Aperçu rapide pour PSMA5 anticorps (ABIN632898)

Antigène: PSMA5 (Proteasome Subunit alpha 5 (PSMA5))

Reactivité: Humain, Souris, Rat, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PSMA5 anticorps

Purification: Affinity purified

Immunogène: PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMA5 Blocking Peptide, (ABIN5615623), is also available for use as a blocking control in assays to test for specificity of this PSMA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMA5

Antigène: PSMA5 (Proteasome Subunit alpha 5 (PSMA5))

Autre désignation: PSMA5

Sujet: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA