C22orf28 anticorps (Middle Region)
-
- Antigène Voir toutes C22orf28 Anticorps
- C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C22orf28 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C22 ORF28 antibody was raised against the middle region of C22 rf28
- Purification
- Affinity purified
- Immunogène
- C22 ORF28 antibody was raised using the middle region of C22 rf28 corresponding to a region with amino acids EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC
- Top Product
- Discover our top product C22orf28 Anticorps primaire
-
anti-Chromosome 22 Open Reading Frame 28 (C22orf28) (AA 52-229) antibody
C22orf28 Reactivité: Humain ELISA, WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Chromosome 22 Open Reading Frame 28 (C22orf28) (AA 201-215) antibodyVerified C22orf28 Reactivité: Humain ELISA, WB, IHC Hôte: Chèvre Polyclonal unconjugated
anti-Chromosome 22 Open Reading Frame 28 (C22orf28) (AA 125-138) antibodyVerified C22orf28 Reactivité: Humain ELISA, WB, IHC Hôte: Chèvre Polyclonal unconjugated
anti-Chromosome 22 Open Reading Frame 28 (C22orf28) antibodyC22orf28 Reactivité: Humain, Souris, Rat ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Chromosome 22 Open Reading Frame 28 (C22orf28) (AA 236-505) antibodyC22orf28 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Chromosome 22 Open Reading Frame 28 (C22orf28) (AA 201-215) antibody (Biotin)Verified C22orf28 Reactivité: Humain ELISA, WB Hôte: Chèvre Polyclonal Biotin
anti-Chromosome 22 Open Reading Frame 28 (C22orf28) (AA 359-408) antibodyC22orf28 Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cheval, Lapin, Cobaye, Poisson zèbre (Danio rerio), Porc, Xenopus laevis, Roussette (Chauve-souris), Poulet, Singe, Insectes, Drosophila melanogaster WB Hôte: Lapin Polyclonal unconjugated
anti-Chromosome 22 Open Reading Frame 28 (C22orf28) (AA 107-156) antibodyC22orf28 Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cheval, Lapin, Cobaye, Porc, Xenopus laevis, Roussette (Chauve-souris), Poulet, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C22ORF28 Blocking Peptide, catalog no. 33R-2666, is also available for use as a blocking control in assays to test for specificity of this C22ORF28 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF28 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))
- Autre désignation
- C22ORF28 (C22orf28 Produits)
- Synonymes
- anticorps C1H22orf28, anticorps C22orf28, anticorps DJ149A16.6, anticorps FAAP, anticorps RP1-149A16.6, anticorps c22orf28, anticorps C10H22orf28, anticorps MGC154502, anticorps HSPC117, anticorps AI255213, anticorps AI463255, anticorps RNA 2',3'-cyclic phosphate and 5'-OH ligase, anticorps tRNA-splicing ligase RtcB homolog, anticorps RTCB, anticorps rtcb, anticorps rtcb.L, anticorps Rtcb
- Sujet
- C22ORF28 is believed to be involved in vinculin binding.
- Poids moléculaire
- 55 kDa (MW of target protein)
-
