RPS27L anticorps (N-Term)

N° du produit ABIN632914

Détail du produit anti-RPS27L anticorps

Antigène: RPS27L (Ribosomal Protein S27L (RPS27L))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS27L est non-conjugé

Application: Western Blotting (WB)

Specificité: RPS27 L antibody was raised against the N terminal of RPS27

Purification: Affinity purified

Immunogène: RPS27 L antibody was raised using the N terminal of RPS27 corresponding to a region with amino acids MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS27L Blocking Peptide, catalog no. 33R-6290, is also available for use as a blocking control in assays to test for specificity of this RPS27L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS27L

Antigène: RPS27L (Ribosomal Protein S27L (RPS27L))

Autre désignation: RPS27L (RPS27L Produits)

Synonymes: anticorps 1810034D23Rik, anticorps ribosomal protein S27 like, anticorps ribosomal protein S27-like, anticorps RPS27L, anticorps Rps27l

Sujet: This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit.

Poids moléculaire: 9 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity