CXorf26 anticorps (Middle Region)

N° du produit ABIN632923

Détail du produit anti-CXorf26 anticorps

Antigène: CXorf26 (Chromosome X Open Reading Frame 26 (CXorf26))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CXorf26 est non-conjugé

Application: Western Blotting (WB)

Specificité: CXORF26 antibody was raised against the middle region of Cxorf26

Purification: Affinity purified

Immunogène: CXORF26 antibody was raised using the middle region of Cxorf26 corresponding to a region with amino acids IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CXORF26 Blocking Peptide, catalog no. 33R-4226, is also available for use as a blocking control in assays to test for specificity of this CXORF26 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF26 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CXorf26

Antigène: CXorf26 (Chromosome X Open Reading Frame 26 (CXorf26))

Autre désignation: CXORF26 (CXorf26 Produits)

Synonymes: anticorps CXorf26, anticorps MGC86379, anticorps CXHXorf26, anticorps 2610029G23Rik, anticorps cb679, anticorps fc12c03, anticorps sb:cb679, anticorps wu:fc12c03, anticorps zgc:92611, anticorps RGD1562502, anticorps polysaccharide biosynthesis domain containing 1, anticorps polysaccharide biosynthesis domain containing 1 S homeolog, anticorps PBDC1, anticorps pbdc1.S, anticorps pbdc1, anticorps Pbdc1

Sujet: The function of Chromosome X ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 26 kDa (MW of target protein)