CNOT11 anticorps (N-Term)

N° du produit ABIN632925

Cet anticorps anti-CNOT11 est un anticorps Lapin Polyclonal détectant CNOT11 dans WB. Adapté pour Humain.

Aperçu rapide pour CNOT11 anticorps (N-Term) (ABIN632925)

Antigène: CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNOT11 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CNOT11 anticorps

Épitope: N-Term

Specificité: C2 ORF29 antibody was raised against the N terminal Of C2 rf29

Purification: Affinity purified

Immunogène: C2 ORF29 antibody was raised using the N terminal Of C2 rf29 corresponding to a region with amino acids NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C2ORF29 Blocking Peptide, (ABIN5612501), is also available for use as a blocking control in assays to test for specificity of this C2ORF29 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNOT11

Antigène: CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))

Autre désignation: C2ORF29

Sujet: The function of Chromosome 2 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 55 kDa (MW of target protein)