TASP1 anticorps (Middle Region)

N° du produit ABIN632927

Détail du produit anti-TASP1 anticorps

Antigène: TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TASP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TASP1 antibody was raised against the middle region of TASP1

Purification: Affinity purified

Immunogène: TASP1 antibody was raised using the middle region of TASP1 corresponding to a region with amino acids QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TASP1 Blocking Peptide, catalog no. 33R-7663, is also available for use as a blocking control in assays to test for specificity of this TASP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TASP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TASP1

Antigène: TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))

Autre désignation: TASP1 (TASP1 Produits)

Synonymes: anticorps 4930485D02Rik, anticorps AW986064, anticorps RGD1308591, anticorps C20orf13, anticorps dJ585I14.2, anticorps taspase, threonine aspartase 1, anticorps taspase 1, anticorps Tasp1, anticorps TASP1

Sujet: This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits.

Poids moléculaire: 19 kDa (MW of target protein)