CHCHD3 anticorps (N-Term)

N° du produit ABIN632928

Détail du produit anti-CHCHD3 anticorps

Antigène: CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHCHD3 est non-conjugé

Application: Western Blotting (WB)

Specificité: CHCHD3 antibody was raised against the N terminal of CHCHD3

Purification: Affinity purified

Immunogène: CHCHD3 antibody was raised using the N terminal of CHCHD3 corresponding to a region with amino acids RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHCHD3 Blocking Peptide, catalog no. 33R-8063, is also available for use as a blocking control in assays to test for specificity of this CHCHD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHCHD3

Antigène: CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))

Autre désignation: CHCHD3 (CHCHD3 Produits)

Synonymes: anticorps MINOS3, anticorps PPP1R22, anticorps 0610041L09Rik, anticorps 1700039J09Rik, anticorps AW558177, anticorps plxna4, anticorps FLJ20420, anticorps wu:fe23h05, anticorps zgc:111837, anticorps si:rp71-18a24.1, anticorps MGC80265, anticorps MGC88973, anticorps coiled-coil-helix-coiled-coil-helix domain containing 3, anticorps coiled-coil-helix-coiled-coil-helix domain containing 3a, anticorps coiled-coil-helix-coiled-coil-helix domain containing 3 L homeolog, anticorps CHCHD3, anticorps Chchd3, anticorps chchd3a, anticorps chchd3.L, anticorps chchd3, anticorps LOC100229580

Sujet: ChChd3 is an inner mitochondrial membrane protein and is essential for maintaining crista integrity and mitochondrial function.

Poids moléculaire: 26 kDa (MW of target protein)