SLFN12 anticorps (Middle Region)

N° du produit ABIN632934

Cet anticorps anti-SLFN12 Polyclonal Lapin (ABIN632934) détecte spécifiquement SLFN12 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SLFN12 anticorps (Middle Region) (ABIN632934)

Antigène: SLFN12 (Schlafen Family Member 12 (SLFN12))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLFN12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLFN12 anticorps

Épitope: Middle Region

Specificité: SLFN12 antibody was raised against the middle region of SLFN12

Purification: Affinity purified

Immunogène: SLFN12 antibody was raised using the middle region of SLFN12 corresponding to a region with amino acids KYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLFN12 Blocking Peptide, (ABIN940131), is also available for use as a blocking control in assays to test for specificity of this SLFN12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLFN12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLFN12

Antigène: SLFN12 (Schlafen Family Member 12 (SLFN12))

Autre désignation: SLFN12

Sujet: The function of SLFN12 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 67 kDa (MW of target protein)