DNAAF2 anticorps (N-Term)

N° du produit ABIN632937

Cet anticorps anti-DNAAF2 est un anticorps Lapin Polyclonal détectant DNAAF2 dans WB. Adapté pour Humain.

Aperçu rapide pour DNAAF2 anticorps (N-Term) (ABIN632937)

Antigène: DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNAAF2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DNAAF2 anticorps

Épitope: N-Term

Specificité: C14 ORF104 antibody was raised against the N terminal Of C14 rf104

Purification: Affinity purified

Immunogène: C14 ORF104 antibody was raised using the N terminal Of C14 rf104 corresponding to a region with amino acids MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF104 Blocking Peptide, (ABIN5612406), is also available for use as a blocking control in assays to test for specificity of this C14ORF104 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF104 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNAAF2

Antigène: DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))

Autre désignation: C14ORF104

Sujet: This protein is highly conserved and involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 91 kDa (MW of target protein)